PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0301s0027.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family Trihelix
Protein Properties Length: 218aa    MW: 24532.6 Da    PI: 4.8375
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0301s0027.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix27.39.5e-091365085
             trihelix 50 Ckekwenlnkrykkikegekkrtsessstcpyfdql 85
                         C+++w+nl+++ykkike+e++ ++e++s +++ +++
  Cagra.0301s0027.1.p  1 CRKRWSNLAGDYKKIKEWESQVKEETESYWVMRNDV 36
                         ******************************999886 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0050777Biological Processnegative regulation of immune response
GO:0071219Biological Processcellular response to molecule of bacterial origin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
CRKRWSNLAG DYKKIKEWES QVKEETESYW VMRNDVRREK KLPGFFDKEV YDIVDGGVIP  60
PAVPTLALGL APASEEGLLP DLDRPNELNS TPVPISVSDV VDKEKQEACK ADQGRLKEKH  120
PEGGNVEGGW TSQEERKRKR TSTSEKEEEE DGEGETKKMQ NQLIEILERN GQLLAAQLEV  180
QNLNLKLDRE QRKDHGDSLV AVLNKLADAV TKIADKL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00288DAPTransfer from AT2G33550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0653640.0AY065364.1 Arabidopsis thaliana unknown protein (At2g33550) mRNA, complete cds.
GenBankAY0963890.0AY096389.1 Arabidopsis thaliana unknown protein (At2g33550) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294638.11e-151hypothetical protein CARUB_v10023675mg
SwissprotQ8VZ201e-126ASR3_ARATH; Trihelix transcription factor ASR3
TrEMBLR0FXU41e-151R0FXU4_9BRAS; Uncharacterized protein
STRINGscaffold_401930.11e-125(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65572843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.11e-118Trihelix family protein